PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 402aa    MW: 43689.5 Da    PI: 8.2621
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002006.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-16119164147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v q+G+ +W+ Ia+++  gR++k+c++rw++ 
      Pbr002006.1 119 RGHWRPAEDSKLKELVGQYGPQNWNVIAEHLD-GRSGKSCRLRWFNQ 164
                      899*****************************.***********996 PP

2Myb_DNA-binding582.1e-18171214146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
      Pbr002006.1 171 RGAFSEEEEERLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 214
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.707114165IPR017930Myb domain
SuperFamilySSF466895.99E-28118212IPR009057Homeodomain-like
SMARTSM007172.6E-13118167IPR001005SANT/Myb domain
PfamPF002492.4E-15119164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-26120172IPR009057Homeodomain-like
CDDcd001677.71E-13122163No hitNo description
PROSITE profilePS5129427.18166220IPR017930Myb domain
SMARTSM007171.5E-15170218IPR001005SANT/Myb domain
PfamPF002494.8E-15171213IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-21173218IPR009057Homeodomain-like
CDDcd001671.39E-7182213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MAFRHLMSDC DGFTRYQDLN FLPPPPVSNQ LSLSNIFGGS TSAMGVVPFS PSSSQQTNKP  60
WSFQALENGG PKNISDLGVL SGVDQKRPTP LNLNLVGEED DDEGRSPAGG RASAKSCVRG  120
HWRPAEDSKL KELVGQYGPQ NWNVIAEHLD GRSGKSCRLR WFNQLDPRIN RGAFSEEEEE  180
RLLAAHRLYG NKWAMIARLF PGRTDNAVKN HWHVIMARSR REQSHVFKRR KPSSPPPPSP  240
LPHVVANFPK NPSTSTESTV SISTINDDST QSASTCTNLS LTPSNKPPPT FFSKFHPFHR  300
PQIIGSPIGS SSSSDGGFNK MIGSNGNGFC ESTGPVRGVG AAAAAMKGVD NSGHQSDSEI  360
SGDESVTTTR TNWSLSREDQ DLHHEKTTTI HFIDFLGVGT A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-341182186106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348255.10.0PREDICTED: myb-related protein 330-like
TrEMBLM5VQV01e-157M5VQV0_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06320.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.17e-65myb domain protein 105